PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.006G107300.1
Common NameB456_006G107300, LOC105799169
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB_related
Protein Properties Length: 681aa    MW: 75482.8 Da    PI: 4.4394
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.006G107300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding31.63.8e-10527570146
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         r rW++++ el++ a++q+G++ +++I + ++ gR++ q+k+++ +
  Gorai.006G107300.1 527 RARWSKQDTELFYGAIRQFGPD-FSLIQQLFP-GRSRHQIKLKFKN 570
                         569*****************88.*********.**********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF159634.4E-25523602No hitNo description
PROSITE profilePS5129310.632525576IPR017884SANT domain
Gene3DG3DSA:1.10.10.603.0E-6525571IPR009057Homeodomain-like
SMARTSM007171.3E-8526574IPR001005SANT/Myb domain
CDDcd001678.14E-7529570No hitNo description
SuperFamilySSF466895.01E-10529577IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 681 aa     Download sequence    Send to blast
MEESDFFQDE PVVTQARAGA KFQPKFKRKA KDGTSGSIPS KPPVILKDVA TTVASAAINA  60
VQVVEPDNVV DDSKVSQVIN PSQVTVTGSL LAEVAVPNCC NDTNSSFERT VGENADLYFG  120
LECLDPLLTQ SSTNDGDNRA DHERTGTEFQ EAGVFPDVDT QDIMFGMTTA SGRRTEKFKP  180
KPRLQTSVPA SPPTVVEWVM HPATARFVPS ETAFKEGSIP DFPSDHVPNC APVDLGSFIP  240
PDPSTSECPV NEELANLAVS SNAGVDLSGD VPDMPTEVIS TIMERNASLV SNPSRESKQS  300
STGGEVNGEG KARKQLREQV TTPHNVDDLE DGTCNDDGLD AELPSYYAID EDKDDNDDDE  360
FNVEHASPKR RTSKRSKKPV NESEKPPRKR RKANEAQKHK KANEASDNPE KEQRKKFSHS  420
TRRKRRFVDE SLLTTPEDEI DFAKVALKDL ILLADYKERI AKKEAKALKE PLTDQSTQKR  480
LNEENARDEE SSIASEQDQG IMDDQVNGSA QSDIYFNYQT LMTKEPRARW SKQDTELFYG  540
AIRQFGPDFS LIQQLFPGRS RHQIKLKFKN EERRSPFKLS EALASRASDH SYFAKVIEQL  600
QQVSGADPEA HGDVSNDLTR EEEEVTPENN EEAAKPKQDE DVAVGDQEAD ITQDHSSLKS  660
NEMDDEDDDD EILNSYQSAF *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1368390KRRTSKRSKKPVNESEKPPRKRR
2369375RRTSKRS
3376391KKPVNESEKPPRKRRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012485033.10.0PREDICTED: transcription factor TFIIIB component B'' homolog isoform X1
TrEMBLA0A0D2NQ130.0A0A0D2NQ13_G
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM51542535
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G39160.13e-39MYB_related family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]